Find closest points origin plane jobs

Filter

My recent searches
Filter by:
Budget
to
to
to
Type
Skills
Languages
    Job State
    18,132 find closest points origin plane jobs found, pricing in USD

    ...as well. Readers earn points every time they rate a story they have read, and every time they leave a comment on a story. Once they accumulate a certain number of points they will be able to use them to purchase product and/or services (yet to be established, but being worked on). As site admin I want to be able to void points IF readers seem to be

    $555 (Avg Bid)
    $555 Avg Bid
    20 bids

    ...calendarized services. - For Users: ** Include payment method and save it (credit card or paypal). - Select type of Service: Motorcycle, Car, pick up, truck. - Select Origin and Destiny on geoMap. - Add instructions, message and photos. - Select immediately service or calendar a pick up date. - When selecting Pick up truck or truck, select

    $8135 (Avg Bid)
    $8135 Avg Bid
    41 bids
    Discourse Plugin Update 6 days left
    VERIFIED

    ...- Shows - Already up-to-date. (not pulling any information) Then when i rebuild it fails ./launcher rebuild app Error is below Ensuring launcher is up to date Fetching origin Launcher is up-to-date Stopping old container /usr/bin/docker stop -t 10 app app cd /pups && git pull && /pups/bin/pups --stdin Already up-to-date. I, [2018-09-23T06:07:01

    $37 (Avg Bid)
    $37 Avg Bid
    4 bids

    I need someone who is a specialist in speed optimization for shopify to make this site fast and must edit code. Attached is a report th...Defer offscreen images 3. Minify CSS Potential 4. Minify JavaScript 5. Defer unused CSS 6. Serve images in next-gen formats 7. Avoid multiple, costly round trips to any origin 8. Preload key requests Potential

    $156 (Avg Bid)
    $156 Avg Bid
    5 bids
    Animated draw 5 days left

    ...content in the circle, Then, goes apearing the puzzle pieces, and the contents draws going from left to right. From the rural zone with the electrical tower in the first plane to the right where is the land close to the river, the bridge, a surveyor close and the small city and fabrics far away in the begining of the river. One of my drafts haves

    $10 / hr (Avg Bid)
    $10 / hr Avg Bid
    5 bids

    ...learn more, visit aerotek.com. The company is an equal opportunity employer and will consider all applications without regards to race, sex, age, color, religion, national origin, veteran status, disability, sexual orientation, gender identity, genetic information or any characteristic protected by law. Job Overview: Global Electronic Distribution

    $33 / hr (Avg Bid)
    $33 / hr Avg Bid
    30 bids

    ...turn-around and directly impact the user. We are looking for someone who is technology savvy, and ready to help us raise scale. Here at PatronArt, we make it easy for customers to find the right artist. You can help us build the new-century way of buying art, and bring art dreams to life. Responsibilities, Skills and Duties: -2-3+ years experience in functional

    $18 (Avg Bid)
    $18 Avg Bid
    4 bids

    ...sequences. Discuss your answer. (5 marks) Question 3 (a) Solve the identity of the below sequence. Document the steps used to identify the sequence. Name the gene and the origin organism. MDWTWILFLVAAATRVHSTSMDPKQTTLLCLVLCLGQRIQAQEGDFPMPFISAKSSPVIPLDGSVKIQCQAIRDA YLTQLMIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSA DRGLVLMPG

    $65 (Avg Bid)
    $65 Avg Bid
    7 bids

    ...The output should be a pipe (|) delimited file with the following column mappings: origin_city --> data located after the text "Origin:", before the first comma origin_state --> data located after the text "Origin:", after the first comma ship_date --> data located after the text "Pickup Date", changed to the YYYY-MM-DD...

    $131 (Avg Bid)
    $131 Avg Bid
    14 bids

    ...The output should be a pipe (|) delimited file with the following column mappings: origin_city --> data located in the "ORIGIN CITY" column origin_state --> data located in the "ST" column to the right of the "ORIGIN CITY" column ship_date --> data located in the "PICKUP DATE" column changed to the YYYY-MM-DD for...

    $145 (Avg Bid)
    $145 Avg Bid
    14 bids
    Trophy icon Logo for a Japanese Product 4 days left

    We want a get a logo redesigned to give it a traditional look. The inherent characteristics should be business like and professional with a Japanese origin. The brand is used to market chemicals and pigments in the international markets. The logo has to be of single colour, rusty and traditional. We should be able to screen print the logo on bags and

    $48 (Avg Bid)
    Guaranteed
    $48
    34 entries

    ...In other words, since the arrow head of the arrow marker is aligned with the x-axis of this marker, we need the x-axis of the arrow coordinate frame to point directly at the origin of the cylinder coordinate frame. (Hint: Use the cross product to define the axis of rotation, and the dot product to infer the required rotation angle.) In the provided startup

    $34 (Avg Bid)
    $34 Avg Bid
    5 bids

    ...- 502 (Bad Gateway) :8100/#/checkout/inicio/product:1 Failed to load -------------------------------------------------: No 'Access-Control-Allow-Origin' header is present on the requested resource. Origin 'http://localhost:8100' is therefore not allowed access. The response had HTTP status code 502. If an opaque response serves your needs, set the request'...

    $108 (Avg Bid)
    $108 Avg Bid
    16 bids
    OpenCV Developer 4 days left
    VERIFIED

    ...phone it's welcome but not necessary. Basically I need to be able to : by a user touch of particular area of screen (I will provide coordinates and the video feed) select closest object and start to track. Be able to track back the object if disappear from screen and comes back. If distance calculation can be done will be an important step, also the

    $32 / hr (Avg Bid)
    $32 / hr Avg Bid
    26 bids
    Trophy icon Logo Design 2 hours left

    ...emigration. We need a modern, easy, friendly, positive and professional logotype. Colors: black, blue, yellow (combination two variants colors). Keywords: embrace, family, plane, leave, meeting, joy, sadness, bridges, ocean, miles, success, love... Name for project is: "Moja BiH". Please make logotype with text in a one row, and with some good symbol

    $30 (Avg Bid)
    $30
    102 entries
    Trophy icon design for mouse pad 15x 22.5cm 3 days left

    Hi designers, can you help us to design a 15x22.5 cm mouse pad? The color need to be blue/green and yellow, it need to be darker in tone for dir...color, this is the design from other company. The slogan is "YOUR PERSONAL VETERINARY MEDICAL SUPPLIER". then will need to add our web page and please add a cat, dog and plane logo under the web page.

    $10 (Avg Bid)
    $10
    11 entries

    ...page form the 4 hexagon & link to the relavent page when user click the button
- newsletter subscription - social media integration • Learning - Input content “symptoms” & “origin” will show the info when user click the text - input ppt , when user click the ppt, will show the ppt on new tab & allow user to save & download the ppt - Will crea...

    $571 (Avg Bid)
    $571 Avg Bid
    27 bids
    Power points 3 days left

    I need help to re design power points but local in Saudi Arabia Khobar

    $21 (Avg Bid)
    $21 Avg Bid
    28 bids

    ...homepage that use Google Maps/Places API and find the closest city that has a store. Also this field should give suggestions of places while user type. - If customer search for a city that has a store, show this city page. - If customer search for a city that hasn´t a store, we need to show the page of closest city that has a store. In the city page we

    $521 (Avg Bid)
    $521 Avg Bid
    36 bids

    building web site for covering the new database system which contain the two Facebook messenger conversations as well the Instagram account with admin plane to create users account ( who reply on the two Facebook messenger conversations and Instagram )

    $211 (Avg Bid)
    $211 Avg Bid
    6 bids

    Want to build a game like clash of clans but with Indian theme. The characters would be from Indian Mythology and from comics related to Indian Origin. Game should work in different platforms(Android & IOS).

    $8 / hr (Avg Bid)
    $8 / hr Avg Bid
    5 bids
    Fit a model to a plane 2 days left
    VERIFIED

    I am trying to fit a model to a plane such as terrain data. I am using jupyter notebook and python

    $230 (Avg Bid)
    $230 Avg Bid
    23 bids
    Target City 2 days left

    We need a game developer to make a game for our website. The basic concept is that we have a blank ...game for our website. The basic concept is that we have a blank map of the UK. We select a city. Customers then have to use an aim and power trigger to throw a pin and get closest to the place we chose. It needs to be fun, easy to use and innovative.

    $959 (Avg Bid)
    $959 Avg Bid
    21 bids

    I'm looking for a watchface for my Samsung Gear S3 which incorporates Strava functionality. Strava doesn't support Samsung wearables, however the closest watchface I have found is the sporty watchface purchased from the Samsung App store. The functionality of this watchface is fine but I don't like the look of it so I'm looking to see if it is worth

    $2 - $8 / hr
    $2 - $8 / hr
    0 bids

    ...Employment Opportunity employer that does not discriminate against any associate or applicant on the basis of race, creed, color, religion, sex (including pregnancy), age, national origin, physical or mental disability, sexual orientation, marital or familial status, genetic information or other basis protected by law ...

    $155 (Avg Bid)
    $155 Avg Bid
    1 bids

    ...invite any of your friends and relatives to join us either the Branch in Canada , United of America or United Kingdom ,all approved applicants are to be granted free air plane ticket and free accommodation and hospitality [login to view URL] are only responsible for work permit visa fees requirements,contact us through this[removed by freelancer.com

    $19 / hr (Avg Bid)
    $19 / hr Avg Bid
    38 bids

    ...project involves writing down major questions and points of confusion, and using the wisdom-of-the-masses to create a unique, modern summary of the book that’s approachable and easy to understand. This work involves reading the book, summarizing the major points, and writing down all questions or points of confusion that you have as you read it. It does

    $21 (Avg Bid)
    $21 Avg Bid
    24 bids

    We are a successful company looking to employ talented individuals on our team who are self-motivated, positive and energetic....opportunity employer. Qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, disability or protected veteran status.

    $545 (Avg Bid)
    $545 Avg Bid
    18 bids

    Mobile app to track and calculate CO2 emissions by citizens caused by their housing, consumption habits, mode of transportation (bicycle, car, plane, etc.) and trips distances (tracked automatically by changes in the smartphone's gps coordinates, the app questions the user how he/she traveled once immobile after each trip). The web platform will have

    $12 / hr (Avg Bid)
    $12 / hr Avg Bid
    5 bids

    want to build a wifi vending machine that uses unifi ap's. that is coin operated and prints out voucher to thermal printer. basically its already been done but its not coin operated here the link: [login to view URL] a code is written to request vouchers to the unif controller requirements: 1. to modify the code or entirely new code to talk to unifi controller and request vouchers t...

    $225 (Avg Bid)
    $225 Avg Bid
    2 bids

    ...family 9) Give the comparative and superlative forms of adjectives 10) Give the past tense and participle forms of verbs 11) Tell the syllable of a word to stress 12) Tell the origin of some foreign words 13) Give the meanings of useful phrases 14) Tell the level of usage of a certain word 15) Tell whether a certain word is a slang word, a taboo word, a

    $397 (Avg Bid)
    $397 Avg Bid
    21 bids

    ...your Doctor and he treats you the conventional way, and treats only the symptoms and, might be missing smaller things such as the origin of your dis-ease? But what exactly is symptomatic treatment? What defines the origin of dis-ease? Imagine living at the bottom of a stream of water which is your life source, and suddenly you realize that this source

    $126 (Avg Bid)
    $126 Avg Bid
    37 bids

    Get email leads from UK AND Luxembourg, Malta, from Those are the industry needed Boat and plane sellers People that work in that field aviation field. Flying boat aircraft Boating & Aviation Aviation Luxembourg Yachthub Horse sellers Horse rank Industrial Equipment supplier Industrials Consumer goods Consumer services Investment management company

    $339 (Avg Bid)
    $339 Avg Bid
    29 bids
    Plane pillow 1 hour left

    ...drawing for a new product I would like to produce and the factory needs a 3d drawing to make new mold for my product. The product I would like to make is a specific type of plane pillow similar to the picture attached but with a few differences. I can send you more exact free style drawings once I receive a quote that I agree on. Please let me know a

    $60 (Avg Bid)
    $60 Avg Bid
    33 bids

    Below are the industry needed: Boat and plane sellers People that work in that field aviation field. Flying boat | aircraft Boating & Aviation Aviation Luxembourg Yachthub Horse sellers Horse rank Industrial Equipment supplier Industrials Consumer goods Consumer services Investment management company Funding business company Construction company Oil

    $477 (Avg Bid)
    $477 Avg Bid
    22 bids

    I have a plan, and I need someone to do takeoffs quantities of the plane for a specific parts (Wood, Finishes, and communication)

    $120 (Avg Bid)
    $120 Avg Bid
    20 bids

    ...strings (search result for lines and search result for points) and returns the JSON of merging the points into the lines as breaks in the lines. The lines and points have a geometrical representation with an x,y,z,measure (where measure is the length the vertex/point exists within the Route). The points in the point array will split the lines at their

    $36 (Avg Bid)
    $36 Avg Bid
    3 bids

    Hi, I want to scrap this site: [login to view URL] I need only 3 column brand, status, origin. No manual scrape only automatic scrape. Please check and bid if you can do this fast. Thanks

    $22 (Avg Bid)
    $22 Avg Bid
    22 bids

    We have a few documents with pre-made tables. You have to write points there.

    $101 (Avg Bid)
    $101 Avg Bid
    50 bids

    Hello, I have just released my first single and am looking to promote it. I am much better at the music side of things and am looking for somebody to write to blogs and labels for possible write-ups of my song. Also looking to increase traffic to my song on Spotify and my social media accounts

    $91 (Avg Bid)
    $91 Avg Bid
    14 bids

    I have a few different items accumulating points in my web application, for $50 I need someone to add all categories together and display the total on users screen.

    $107 (Avg Bid)
    $107 Avg Bid
    10 bids

    You can spend a clever way on advertising for $ 215, so that you meet the needs of everyday people by seeing t...clever way on advertising for $ 215, so that you meet the needs of everyday people by seeing the advertiser's needs, such as tips on how to buy cheap from a cheap place and the origin of goods and delivery at the buyer's preferred location.

    $30 (Avg Bid)
    $30 Avg Bid
    1 bids

    I sent this photo to a graphic designer and he took a lot of time but he did not do it appropriately. I have the original photo but this is how I want to photo t...Photoshop better texture, more like a painting more like a digital look. I’m looking for someone to take this photo or the original photo make it the best version of this or closest to it

    $91 (Avg Bid)
    $91 Avg Bid
    62 bids

    Writing a book about ideas and thoughts about life matters such as how things get done, does prayer has any thing with manafistation, does magic spells work, what is the action and reversed action, how we should think about it, when we need to be extereemer in thinking when not , what are the subjects to be treated with balance consedrations, the book about qustions and answers from real experianc...

    $133 (Avg Bid)
    $133 Avg Bid
    18 bids

    I need the following works: 1. Kinematic Analysis of plane-symmetric 6-revolute Bricard Linkage using MATLAB. 2. Modelling and simulation of the plane-symmetric 6-revolute Bricard Linkage in Simulink. 3. Plotting (graphical representation) of the trajectory (motion behavior) of the plane-symmetric 6-revolute Bricard Linkage obtained from the analysis

    $69 (Avg Bid)
    $69 Avg Bid
    1 bids

    I need the following works: 1. Kinematic Analysis of plane-symmetric 6-revolute Bricard Linkage using MATLAB. 2. Modelling and simulation of the plane-symmetric 6-revolute Bricard Linkage in Simulink. 3. Plotting (graphical representation) of the trajectory (motion behavior) of the plane-symmetric 6-revolute Bricard Linkage obtained from the analysis

    $69 (Avg Bid)
    $69 Avg Bid
    1 bids

    Hello, I need the following works: 1. Kinematic Analysis of plane-symmetric 6-revolute Bricard Linkage using MATLAB. 2. Modelling and simulation of the plane-symmetric 6-revolute Bricard Linkage in Simulink. 3. Plotting (graphical representation) of the trajectory (motion behavior) of the plane-symmetric 6-revolute Bricard Linkage obtained from the analysis

    $69 (Avg Bid)
    $69 Avg Bid
    1 bids

    I have an APK file that I want to change the URL it is pointing to. I do not have the source code.

    $23 (Avg Bid)
    $23 Avg Bid
    11 bids

    ...ask for points (from video ads) -The list of items must be easy to operate and editable. -Application and total points must run somewhere in the distance so that the application can not be tricked by luckypatcher, cheatengine, etc. The application design is already done. The application must show "in profile": - the total number of points collected

    $383 (Avg Bid)
    $383 Avg Bid
    18 bids

    Hello, I need the following works: 1. Kinematic Analysis of plane-symmetric 6-revolute Bricard Linkage using MATLAB. 2. Modelling and simulation of the plane-symmetric 6-revolute Bricard Linkage in Simulink. 3. Plotting (graphical representation) of the trajectory (motion behavior) of the plane-symmetric 6-revolute Bricard Linkage obtained from the analysis

    $69 (Avg Bid)
    $69 Avg Bid
    1 bids