Magento shipping origin jobs

Filter

My recent searches
Filter by:
Budget
to
to
to
Type
Skills
Languages
    Job State
    13,937 magento shipping origin jobs found, pricing in USD

    I currently have an issue with getting my carrier option for Canada to show up. Can you help me get it working asap?

    $6 / hr (Avg Bid)
    $6 / hr Avg Bid
    8 bids

    We are looking for a shipping manager who can setup and coordinate shipments by using a shipping software. We have a lot of shipments from Europe to the U.S. and use different software like freightpop. Contractor would work with freightpop on a daily basis as well as setting up new shipping carriers in freightpop. We are looking for an assistant

    $6 / hr (Avg Bid)
    $6 / hr Avg Bid
    7 bids
    Trophy icon Wine Farm & Bottle LOGOTYPE 8 days left

    ...next to a brook and with a water mill. Type of production: High quality red and white wine: WHAT WE ARE LOOKING FOR: A logo concept that translates the ancient origin and past of the farm, allied to its location and that is based on the structuring of the idea considering the following 4 points: Wine; Brook; Water Mill; Royals

    $94 (Avg Bid)
    Guaranteed Top Contest
    $94
    14 entries

    ...products are very tiny and low in weight. The idea is to send it by letter to Asia and Europe. For that kind of work I need someone who is able to help me with that drop shipping. If you are the one you will get the products in small quantities (max. 5 kg) you have to unbox it and put it in a box or an envelope that is able to send it by China Post

    $6 / hr (Avg Bid)
    $6 / hr Avg Bid
    1 bids

    The website is mainly a repository and incident tracker of news all around the world. It provides the client of a way to both read the news and s...Project Proposal'. also I've attached herewith a sample of the map screenshot that shows the risk level of certain countries in some way. Icons should be added to pinpoint the origin of the stored news.

    $538 (Avg Bid)
    $538 Avg Bid
    92 bids

    [login to view URL] i need Name , Title, Company name ,And linkedin Url 1500 need budge $4

    $2 / hr (Avg Bid)
    $2 / hr Avg Bid
    28 bids

    Need a Draft person to design and draw a Chalet made out of a Shipping Container. It will have one bedroom and an adjoining bathroom made again with a shipping container. It will also have a decking at the front. The decking will be flat packed for installation on sight

    $131 (Avg Bid)
    $131 Avg Bid
    49 bids

    ...calendarized services. - For Users: ** Include payment method and save it (credit card or paypal). - Select type of Service: Motorcycle, Car, pick up, truck. - Select Origin and Destiny on geoMap. - Add instructions, message and photos. - Select immediately service or calendar a pick up date. - When selecting Pick up truck or truck, select

    $8433 (Avg Bid)
    $8433 Avg Bid
    100 bids

    Requirement: We have completed the basic Fedex shipping account configured in our website (Magento 2.2.5) through fedex production account connected in backend. Its works good. Fedex pass the rate in frontend website as per our order lbs value request. Need to customize the fedex shipping rate as per our own logical calculations. Break the Order/product

    $232 (Avg Bid)
    $232 Avg Bid
    27 bids

    I want to start Shopify Dropshiping business help me in building Shopify store and facebook advertisement thanks

    $4 / hr (Avg Bid)
    $4 / hr Avg Bid
    10 bids

    Fix our Shipping Costs choices ( UPS , Fedex ) Which have disappeared in our new copy of the environment Please see images: Get these fixed and I have more for you. I am looking for a reliable , respectable, time conscience dev. These are test fixes- I have more work. Please see images. Preview of Existing Environment: Is there a better way to connect

    $56 (Avg Bid)
    $56 Avg Bid
    3 bids
    Discourse Plugin Update 4 days left
    VERIFIED

    ...- Shows - Already up-to-date. (not pulling any information) Then when i rebuild it fails ./launcher rebuild app Error is below Ensuring launcher is up to date Fetching origin Launcher is up-to-date Stopping old container /usr/bin/docker stop -t 10 app app cd /pups && git pull && /pups/bin/pups --stdin Already up-to-date. I, [2018-09-23T06:07:01

    $37 (Avg Bid)
    $37 Avg Bid
    4 bids

    I need someone who is a specialist in speed optimization for shopify to make this site fast and must edit code. Attached is a report th...Defer offscreen images 3. Minify CSS Potential 4. Minify JavaScript 5. Defer unused CSS 6. Serve images in next-gen formats 7. Avoid multiple, costly round trips to any origin 8. Preload key requests Potential

    $156 (Avg Bid)
    $156 Avg Bid
    5 bids

    Urgent Yoast SEO creator + Shipping options + Checkout page setup I'm looking for someone to help on creating an ecommerce setup page, shipping options and create SEO with Yoast SEO. SKILLS - YoastSEO + Woocommerce + Enfold theme

    $102 (Avg Bid)
    $102 Avg Bid
    35 bids

    I want you to write a class in PHP which has methods for FedEx API calls to create a new shipment and fetch rates and respective carriers

    $30 (Avg Bid)
    $30 Avg Bid
    6 bids

    Fix our Shipping Costs choices ( UPS , Fedex ) Which have disappeared in our new copy of the environment Please see images: Get these fixed and I have more for you. I am looking for a reliable , respectable, time conscience dev. These are test fixes- I have more work. Please see images. Preview of Existing Environment: Is there a better way to connect

    $194 (Avg Bid)
    $194 Avg Bid
    13 bids

    ...sequences. Discuss your answer. (5 marks) Question 3 (a) Solve the identity of the below sequence. Document the steps used to identify the sequence. Name the gene and the origin organism. MDWTWILFLVAAATRVHSTSMDPKQTTLLCLVLCLGQRIQAQEGDFPMPFISAKSSPVIPLDGSVKIQCQAIRDA YLTQLMIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSA DRGLVLMPG

    $65 (Avg Bid)
    $65 Avg Bid
    7 bids

    ...The output should be a pipe (|) delimited file with the following column mappings: origin_city --> data located after the text "Origin:", before the first comma origin_state --> data located after the text "Origin:", after the first comma ship_date --> data located after the text "Pickup Date", changed to the YYYY-MM-DD...

    $131 (Avg Bid)
    $131 Avg Bid
    14 bids

    ...The output should be a pipe (|) delimited file with the following column mappings: origin_city --> data located in the "ORIGIN CITY" column origin_state --> data located in the "ST" column to the right of the "ORIGIN CITY" column ship_date --> data located in the "PICKUP DATE" column changed to the YYYY-MM-DD for...

    $140 (Avg Bid)
    $140 Avg Bid
    15 bids
    Trophy icon Logo for a Japanese Product 2 days left

    We want a get a logo redesigned to give it a traditional look. The inherent characteristics should be business like and professional with a Japanese origin. The brand is used to market chemicals and pigments in the international markets. The logo has to be of single colour, rusty and traditional. We should be able to screen print the logo on bags and

    $48 (Avg Bid)
    Guaranteed
    $48
    34 entries

    ...In other words, since the arrow head of the arrow marker is aligned with the x-axis of this marker, we need the x-axis of the arrow coordinate frame to point directly at the origin of the cylinder coordinate frame. (Hint: Use the cross product to define the axis of rotation, and the dot product to infer the required rotation angle.) In the provided startup

    $36 (Avg Bid)
    $36 Avg Bid
    4 bids

    ...- 502 (Bad Gateway) :8100/#/checkout/inicio/product:1 Failed to load -------------------------------------------------: No 'Access-Control-Allow-Origin' header is present on the requested resource. Origin 'http://localhost:8100' is therefore not allowed access. The response had HTTP status code 502. If an opaque response serves your needs, set the request'...

    $108 (Avg Bid)
    $108 Avg Bid
    16 bids

    I need to enable Shipping Methods on the bottom of checkout page . Website [login to view URL] . Thank you.

    $26 (Avg Bid)
    $26 Avg Bid
    19 bids

    ...page form the 4 hexagon & link to the relavent page when user click the button
- newsletter subscription - social media integration • Learning - Input content “symptoms” & “origin” will show the info when user click the text - input ppt , when user click the ppt, will show the ppt on new tab & allow user to save & download the ppt - Will crea...

    $571 (Avg Bid)
    $571 Avg Bid
    27 bids

    ...Salesforce Opportunity object, providing Account Manager the ability to send shipping labels via email from within Salesforce for clients to ship their items to our office. How it will work: 1. Salesforce user clicks button from the Opportunity object, labeled "Generate Shipping Label" 2. A Visualforce page will open, asking the Account Manager to select

    $4213 (Avg Bid)
    $4213 Avg Bid
    38 bids

    I meet problems of prestashop shipping method configuration. We set 4 carriers to USA, But only 2 carrier there and the freight cost is wrong. All other country seems works right, but only America is wrong. Anyone can help to check and fix this problem please contact me soon.

    $32 (Avg Bid)
    $32 Avg Bid
    2 bids
    Build a mobile game 23 hours left

    Want to build a game like clash of clans but with Indian theme. The characters would be from Indian Mythology and from comics related to Indian Origin. Game should work in different platforms(Android & IOS).

    $8 / hr (Avg Bid)
    $8 / hr Avg Bid
    6 bids

    I need some changes to an existing website. I have an o...to an existing website. I have an online store built in WordPress. I need to enable the automatic shipping calculation based on Weight. We prefer not to use any plugins but if I need a plugin we can install one. Its needs to auto calculate the shipping depending on total weight on the cart.

    $41 (Avg Bid)
    $41 Avg Bid
    13 bids

    ...Employment Opportunity employer that does not discriminate against any associate or applicant on the basis of race, creed, color, religion, sex (including pregnancy), age, national origin, physical or mental disability, sexual orientation, marital or familial status, genetic information or other basis protected by law ...

    $155 (Avg Bid)
    $155 Avg Bid
    1 bids

    1. The topic assigned to shopping tips of each store, you should use your own language to introduce how to save money. For example, signing up,free shipping, coupon codes, gift card, bulk order, group discounts, military discounts, etc. 2. Try to use {keywords} in each shopping tips 3. Almost no errors of vocabulary, spelling, punctuation or syntax

    $90 (Avg Bid)
    $90 Avg Bid
    10 bids

    ...in excel, many conditions and keep the profit margin at least 20%. The varibable are . Shipping cost . Product cost . Free shipping rate The product more cheap cost 1€/kg The markup is 50% The fix costs are 3€ The shipping cost depend from weight The free shipping is when order total is > 39€ The module is already done (look [login to view URL])

    $26 (Avg Bid)
    $26 Avg Bid
    15 bids

    1. The topic assigned to shopping tips of each store, you should use your own language to introduce how to save money. For example, signing up, free shipping, coupon codes, gift card, bulk order, group discounts, military discounts, etc. 2. Try to use {keywords} in each shopping tips 3. Almost no errors of vocabulary, spelling, punctuation or syntax

    $85 (Avg Bid)
    $85 Avg Bid
    15 bids

    1. The topic assigned to shopping tips of each store, you should use your own language to introduce how to save money. For example, signing up, free shipping, coupon codes, gift card, bulk order, group discounts, military discounts, etc. 2. Try to use {keywords} in each shopping tips 3. Almost no errors of vocabulary, spelling, punctuation or syntax

    $57 (Avg Bid)
    $57 Avg Bid
    10 bids

    We are a successful company looking to employ talented individuals on our team who are self-motivated, positive and energetic....opportunity employer. Qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, disability or protected veteran status.

    $543 (Avg Bid)
    $543 Avg Bid
    20 bids

    ...to be able to export sales/shipping data from our ebay store and import it into our Australia Post eParcel account to create the relevant shipping labels & picking list. Once picked and packed the tracking number from eParcel needs to then be uploaded back to the eBay system. We need to be able to catch out any shipping address errors that customers

    $172 (Avg Bid)
    $172 Avg Bid
    6 bids

    ...family 9) Give the comparative and superlative forms of adjectives 10) Give the past tense and participle forms of verbs 11) Tell the syllable of a word to stress 12) Tell the origin of some foreign words 13) Give the meanings of useful phrases 14) Tell the level of usage of a certain word 15) Tell whether a certain word is a slang word, a taboo word, a

    $397 (Avg Bid)
    $397 Avg Bid
    21 bids

    I want a Dropshipping website in Wordpress. Theme Similar to [login to view URL] Budget : $30 *Only people who can complete within this budget please apply

    $57 (Avg Bid)
    $57 Avg Bid
    9 bids

    We want to make a website that connects users to logistics [login to view URL] what we want is the user to input the type of product (user wants to transport),location(from where the logistics company will pick up the product,location(from where the logistics company will drop the product).As the user searches it,we want to give the user a list of companies which can do this transportation and we ...

    $513 (Avg Bid)
    $513 Avg Bid
    11 bids

    ...your Doctor and he treats you the conventional way, and treats only the symptoms and, might be missing smaller things such as the origin of your dis-ease? But what exactly is symptomatic treatment? What defines the origin of dis-ease? Imagine living at the bottom of a stream of water which is your life source, and suddenly you realize that this source

    $126 (Avg Bid)
    $126 Avg Bid
    38 bids

    Hello Web Developers! Please learn how to read. Recruiter is not allowed to join! Please make sure that you will watch this video: [login to view URL] . I am launching a project and I need a member to be part of my team to develop a Dropshipping platform. I created the structured plan. Please see the attached MS Word Document. Answer the questions found in the MS Word and send your proposal (Not ...

    $975 (Avg Bid)
    $975 Avg Bid
    9 bids

    Create this suc...specifications within budget and I will aware you another project. Create 3 sales for me and I will consider paying you chunk out of profit. Deliverable is to ensure drop shipping e commerce website is in a state to run live fit for function and is able to generate alteast 3 sales upon completion by continuous traffic and prospects.

    $11 / hr (Avg Bid)
    $11 / hr Avg Bid
    10 bids

    Hi, I want to scrap this site: [login to view URL] I need only 3 column brand, status, origin. No manual scrape only automatic scrape. Please check and bid if you can do this fast. Thanks

    $22 (Avg Bid)
    $22 Avg Bid
    22 bids

    Hello Web Developers! Please learn how to read. Please make sure that you will watch this video: [login to view URL] . I am launching a project and I need a member to be part of my team to develop a Dropshipping platform. I created the structured plan. Please see the attached MS Word Document. Answer the questions found in the MS Word and send your proposal (Not answering the questions and no pro...

    $1202 (Avg Bid)
    $1202 Avg Bid
    20 bids

    Your first objective is to find the minimum cost of shipping some standard sets of items, and also the allo- cation and positioning of items to/on craft for each of these sets. You must determine the optimal solution for the following Sample Mixes listed in Table 2—but you must also give consideration to your solution (problem formulation and algorithms)

    $184 (Avg Bid)
    $184 Avg Bid
    13 bids

    Hello I am after experts in word Press and Ali Express drop shipping API setup. The project we are doing is setting up Ali Express Drop shipping store while adding the following features. Customers can login and buy products by default, however we want to be able to add following after customer creates and account: 1. Account to be created as personal

    $1541 (Avg Bid)
    $1541 Avg Bid
    35 bids

    You can spend a clever way on advertising for $ 215, so that you meet the needs of everyday people by seeing t...clever way on advertising for $ 215, so that you meet the needs of everyday people by seeing the advertiser's needs, such as tips on how to buy cheap from a cheap place and the origin of goods and delivery at the buyer's preferred location.

    $30 (Avg Bid)
    $30 Avg Bid
    1 bids

    The image must have a dimension of 848 x ...px. Everyone who see this image should knows immediately what is meant. In terms of color, it should match the design of the attached screenshot. The text "worldwide free shipping" should be changeable so that it can be translated in another language. So transfer the graphic file is preferably in psd format.

    $11 (Avg Bid)
    Guaranteed
    $11
    14 entries

    need shipping agent who can get me direct rates from shipping carriers and not other freight forwarders as I am starting a shipping company

    $1094 (Avg Bid)
    $1094 Avg Bid
    10 bids

    ...understands e-commerce business and wants to grow within our company. Position Virtual Assistant - Order Shipping Specialist Job Description Update shipping tracking ID’s daily for orders in a timely manner Update Google Sheet - Excel with order shipping information Requirements Must have experience with Amazon and eBay platform Proficient in Microsoft

    $137 (Avg Bid)
    $137 Avg Bid
    51 bids

    Hi i want to build shipping website with accounts for each customer to track his shipments basic but functional web site with quote tool . to calculate the cost of moving cars from different auction locations around UAS to USA sea ports for international shipping by containers to few destinations

    $215 (Avg Bid)
    $215 Avg Bid
    24 bids