Soul origin profile jobs

Filter

My recent searches
Filter by:
Budget
to
to
to
Type
Skills
Languages
    Job State
    8,626 soul origin profile jobs found, pricing in USD

    ...proficient writer, I am more after authentic content that accurately describes the tea culture of Iraq. You just have to have a passion for tea and an understanding of the heart and soul of the tea culture in Iraq and the local language used. A writing brief will be provided that outlines the specifications required in order to capture the tea culture.

    $77 (Avg Bid)
    $77 Avg Bid
    15 bids
    Trophy icon Logo design 4 days left

    I am starting up a Doula business (labor support for women having babies) named Spirited Soul Birth Services. Im looking for a logo design of a silhouette of a pregnant woman or female-like spirit/shape embracing her belly with a seed growing inside of it. Ive attached a few ideas below?

    $68 (Avg Bid)
    Guaranteed
    $68
    35 entries

    Given a csv file create a line and bar chart that compares last available ORIGIN DATE Value with the previous ORIGIN DATE Value, for each Location, Model and Forecast Type (check csv file at: [login to view URL]) The x axis is the FORECAST DATE, the y axis is the VALUE. One line is the latest available

    $151 (Avg Bid)
    $151 Avg Bid
    16 bids

    There is to be a special and very attractive creation, which will make your friend feel very happy about this congratulation...so as not to annoy your friend. It prevails in blue color and dominates some balloons as a symbol of his birthday. I also decided to write a greetings supposedly to touch his soul and make him happier for your congratulations.

    $29 (Avg Bid)
    $29 Avg Bid
    37 bids
    Trophy icon Wine Farm & Bottle LOGOTYPE 8 days left

    ...next to a brook and with a water mill. Type of production: High quality red and white wine: WHAT WE ARE LOOKING FOR: A logo concept that translates the ancient origin and past of the farm, allied to its location and that is based on the structuring of the idea considering the following 4 points: Wine; Brook; Water Mill; Royals

    $94 (Avg Bid)
    Guaranteed Top Contest
    $94
    18 entries

    The website is mainly a repository and incident tracker of news all around the world. It provides the client of a way to both read the news and s...Project Proposal'. also I've attached herewith a sample of the map screenshot that shows the risk level of certain countries in some way. Icons should be added to pinpoint the origin of the stored news.

    $543 (Avg Bid)
    $543 Avg Bid
    92 bids

    [login to view URL] i need Name , Title, Company name ,And linkedin Url 1500 need budge $4

    $2 / hr (Avg Bid)
    $2 / hr Avg Bid
    28 bids

    I am more after authentic content that accurately describes the tea culture of the Middle East. You just have to have a passion for tea and an understanding of the heart and soul of the tea culture in the Middle East. A writing brief will be provided that outlines the specifications required in order to capture the tea culture. If you think you are

    $66 (Avg Bid)
    $66 Avg Bid
    61 bids

    ...Presents Event Name - Old School Night Pajama Jam Party!! (columbus day weekend) Event Date - Friday Oct. 5th Music By - DJ Ghost (Playing nothing but the Hottest!! Hip Hop, Soul Train, House, Reggea and so much more!!) Extra Curricular Activities - Best PJ's Wins Cash Grand Prize Event Details - Doors Open at 9pm, 21+ Event/ Proper ID is a Must,

    $50 (Avg Bid)
    Featured Guaranteed Top Contest
    $50
    15 entries

    I'm a project manager and one of my clients is looking for someone to handle copywriting: 1) Newsletters and blog posts - typically 1-2 times per month 2) We...contest to see who is best able to capture her voice and speak to the target audience. Please write a promotion email for this upcoming program: [login to view URL]

    $40 (Avg Bid)
    $40
    0 entries

    I am looking for someone to provide vector illustrations at the same level of detail of attached Fila examples, the shoe design sketch is also attached I need left right soul views. Thank you.

    $22 (Avg Bid)
    $22 Avg Bid
    30 bids

    ...calendarized services. - For Users: ** Include payment method and save it (credit card or paypal). - Select type of Service: Motorcycle, Car, pick up, truck. - Select Origin and Destiny on geoMap. - Add instructions, message and photos. - Select immediately service or calendar a pick up date. - When selecting Pick up truck or truck, select

    $8440 (Avg Bid)
    $8440 Avg Bid
    101 bids
    Discourse Plugin Update 3 days left
    VERIFIED

    ...- Shows - Already up-to-date. (not pulling any information) Then when i rebuild it fails ./launcher rebuild app Error is below Ensuring launcher is up to date Fetching origin Launcher is up-to-date Stopping old container /usr/bin/docker stop -t 10 app app cd /pups && git pull && /pups/bin/pups --stdin Already up-to-date. I, [2018-09-23T06:07:01

    $37 (Avg Bid)
    $37 Avg Bid
    4 bids
    Try to be good 3 days left

    I need you to write some articles. Try to be a good God made human being in the...life, therefore, should be to try to be good in order to ensure to ourselves and to others the kingdom of peace and happiness and happiness and the tarnquilltiy of mind and soul. Try to be good is, therefore, the golden precept we should follow and practice in our lives.

    $22 (Avg Bid)
    $22 Avg Bid
    19 bids

    I need someone who is a specialist in speed optimization for shopify to make this site fast and must edit code. Attached is a report th...Defer offscreen images 3. Minify CSS Potential 4. Minify JavaScript 5. Defer unused CSS 6. Serve images in next-gen formats 7. Avoid multiple, costly round trips to any origin 8. Preload key requests Potential

    $156 (Avg Bid)
    $156 Avg Bid
    5 bids

    Build a branding strategy and design all materials needed for the website, log, graphical chart, business card, pricing menu... Need help to build a true new image for my current website: [login to view URL] this project should be finished pretty fast before the peak season for facials services

    $978 (Avg Bid)
    $978 Avg Bid
    56 bids

    ...keywords. - Tone: Our tone is positive, inspiring, motivate, energetic and confident. Your writing should be reader-friendly (keep it simple!) and should speak to the heart, soul and mind. - Target Audience: aged 20-50 people, workers etc. USA - Purpose of the Content: To inspiring readers. - Recommended Article Length: 2000 – 2500 words. - Formatting:

    $1216 (Avg Bid)
    $1216 Avg Bid
    40 bids

    ...sequences. Discuss your answer. (5 marks) Question 3 (a) Solve the identity of the below sequence. Document the steps used to identify the sequence. Name the gene and the origin organism. MDWTWILFLVAAATRVHSTSMDPKQTTLLCLVLCLGQRIQAQEGDFPMPFISAKSSPVIPLDGSVKIQCQAIRDA YLTQLMIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSA DRGLVLMPG

    $65 (Avg Bid)
    $65 Avg Bid
    7 bids

    ...The output should be a pipe (|) delimited file with the following column mappings: origin_city --> data located after the text "Origin:", before the first comma origin_state --> data located after the text "Origin:", after the first comma ship_date --> data located after the text "Pickup Date", changed to the YYYY-MM-DD...

    $131 (Avg Bid)
    $131 Avg Bid
    14 bids

    ...The output should be a pipe (|) delimited file with the following column mappings: origin_city --> data located in the "ORIGIN CITY" column origin_state --> data located in the "ST" column to the right of the "ORIGIN CITY" column ship_date --> data located in the "PICKUP DATE" column changed to the YYYY-MM-DD for...

    $140 (Avg Bid)
    $140 Avg Bid
    15 bids
    Trophy icon Logo for a Japanese Product 2 days left

    We want a get a logo redesigned to give it a traditional look. The inherent characteristics should be business like and professional with a Japanese origin. The brand is used to market chemicals and pigments in the international markets. The logo has to be of single colour, rusty and traditional. We should be able to screen print the logo on bags and

    $48 (Avg Bid)
    Guaranteed
    $48
    34 entries

    ...In other words, since the arrow head of the arrow marker is aligned with the x-axis of this marker, we need the x-axis of the arrow coordinate frame to point directly at the origin of the cylinder coordinate frame. (Hint: Use the cross product to define the axis of rotation, and the dot product to infer the required rotation angle.) In the provided startup

    $36 (Avg Bid)
    $36 Avg Bid
    4 bids

    ...- 502 (Bad Gateway) :8100/#/checkout/inicio/product:1 Failed to load -------------------------------------------------: No 'Access-Control-Allow-Origin' header is present on the requested resource. Origin 'http://localhost:8100' is therefore not allowed access. The response had HTTP status code 502. If an opaque response serves your needs, set the request'...

    $108 (Avg Bid)
    $108 Avg Bid
    16 bids

    ...page form the 4 hexagon & link to the relavent page when user click the button
- newsletter subscription - social media integration • Learning - Input content “symptoms” & “origin” will show the info when user click the text - input ppt , when user click the ppt, will show the ppt on new tab & allow user to save & download the ppt - Will crea...

    $571 (Avg Bid)
    $571 Avg Bid
    27 bids
    Property Website 16 hours left

    Hi, I need a website where Estate Agents can advertise properties that are available to rent and on sale. I need someone who can put their heart and soul into the complete design and development of the site and should have experience in developing such sites.

    $866 (Avg Bid)
    $866 Avg Bid
    94 bids

    Want to build a game like clash of clans but with Indian theme. The characters would be from Indian Mythology and from comics related to Indian Origin. Game should work in different platforms(Android & IOS).

    $8 / hr (Avg Bid)
    $8 / hr Avg Bid
    6 bids

    ...Employment Opportunity employer that does not discriminate against any associate or applicant on the basis of race, creed, color, religion, sex (including pregnancy), age, national origin, physical or mental disability, sexual orientation, marital or familial status, genetic information or other basis protected by law ...

    $155 (Avg Bid)
    $155 Avg Bid
    1 bids

    We are a successful company looking to employ talented individuals on our team who are self-motivated, positive and energetic....opportunity employer. Qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, disability or protected veteran status.

    $543 (Avg Bid)
    $543 Avg Bid
    20 bids

    ...family 9) Give the comparative and superlative forms of adjectives 10) Give the past tense and participle forms of verbs 11) Tell the syllable of a word to stress 12) Tell the origin of some foreign words 13) Give the meanings of useful phrases 14) Tell the level of usage of a certain word 15) Tell whether a certain word is a slang word, a taboo word, a

    $397 (Avg Bid)
    $397 Avg Bid
    21 bids

    ...your Doctor and he treats you the conventional way, and treats only the symptoms and, might be missing smaller things such as the origin of your dis-ease? But what exactly is symptomatic treatment? What defines the origin of dis-ease? Imagine living at the bottom of a stream of water which is your life source, and suddenly you realize that this source

    $126 (Avg Bid)
    $126 Avg Bid
    38 bids

    ...evolving marketing landscape in search of culturally engaging solutions to complicated business challenges. We are a creatively led travel and tourism company with a digital soul. Our work is custom built by storytellers and strategists with flair of exploring the latest in media and technology. Most of all, we stand behind our ideas and believe in creativity

    $310 (Avg Bid)
    $310 Avg Bid
    6 bids

    -Fine tuning the detail to the Soul Scan electronic medical record (SSEMR). -Finished, working copy of a Soul Scan Assessment Tool (SSAT). -Finished, working model of the SSEMR. -Finished demo video explaining the SSEMR and SSAT.

    $487 (Avg Bid)
    $487 Avg Bid
    12 bids

    I'm looking for SPOKEN WORD POETS, HIP HOP ARTISTS & NEO SOUL/R&B SINGERS to add to a series of event lineups I have coming every 1st & 3rd Thursday in Williamsburg, Brooklyn. I'm currently adding talent to my monthly performance calendar for September 27th, October 4th & October 18th. You will be expected to sell tickets to perform. All interested

    $56 (Avg Bid)
    $56 Avg Bid
    9 bids

    Hi, I want to scrap this site: [login to view URL] I need only 3 column brand, status, origin. No manual scrape only automatic scrape. Please check and bid if you can do this fast. Thanks

    $22 (Avg Bid)
    $22 Avg Bid
    22 bids

    ...******************* SUMMARY: +get 30 of your friends/classmates/church/family/community/civic group etc to upload videos to MY and THEIR social media pages singing "Knit my soul with you" in at least 2 languages per person +if one persons upload more than one video, it counts as one +at least 2 different languages per person (persons can do more languages)(one

    $100 (Avg Bid)
    $100 Avg Bid
    1 bids

    You can spend a clever way on advertising for $ 215, so that you meet the needs of everyday people by seeing t...clever way on advertising for $ 215, so that you meet the needs of everyday people by seeing the advertiser's needs, such as tips on how to buy cheap from a cheap place and the origin of goods and delivery at the buyer's preferred location.

    $30 (Avg Bid)
    $30 Avg Bid
    1 bids

    I need my dissertation edited for content, language, and grammar, as well as APA style and I need a pretty quick turn around. My dissertation is 68, 125 words. It is a study of two mural projects occurring in a bordertown and how the projects impacted students, teachers, and community members in one of the most dangerous cities on the planet.

    $475 (Avg Bid)
    $475 Avg Bid
    46 bids

    ...want our about us text to show 3) we want on the home page some pictures and text boxes, 4 of these would be wonderful, off set (___)(.._...) (......)(...) 4) for the site origin plugin to work so we can do drop in place work or another click and play plugin 5) we wish for shops api to be showing ( so people can locate stores) 6) a points reward scheme

    $212 (Avg Bid)
    $212 Avg Bid
    57 bids

    ...qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, gender expression, national origin, age, protected veteran or disabled status, or genetic information....

    $11 / hr (Avg Bid)
    $11 / hr Avg Bid
    52 bids

    ...the agreed mode of transportation. 3. Review of Documents: 3.1. The related required documents (such as the Packing List, Certificate of Conformity, Certificate of Origin, Test Certificates & etc.). Freelancer has to take photos from each step. Inspection date : 06.09.2018 - Morning 4. Prepare inspection report....

    $129 (Avg Bid)
    Local
    $129 Avg Bid
    2 bids
    Trophy icon MAD Men Riders Ended

    Our Soul Purpose for this Motorcycle Group of Free Rider Friends Named: MAD Men Riders is to project an image to the outside market or audience in this case the whole world that this is a group of Crazy MAD Men & Women Riding Group and are based on FREEDOM and understanding (Chemistry) and RESPECT to each other. We need to create a LOGO that will

    $100 (Avg Bid)
    Guaranteed
    $100
    13 entries
    Trophy icon FitDistrict Ended

    ...and visualize the type of class they are about to have. The instructors in each studio are high in energy, motivation, knowledge, and of course the physical coupled with loud, soul pumping music create an fun, exciting, transformational experience. The Energy Cafe is attached to the studios and has a separate public entrance, will offer fresh smoothies

    $190 (Avg Bid)
    Guaranteed
    $190
    139 entries

    I'm a qualified graphics designer, and I believe in designing as my occupation, thereby treated my customers to meet their wants and maintain loyalty to every soul,

    $25 / hr (Avg Bid)
    $25 / hr Avg Bid
    1 bids

    I have a script for a three page comic book named "Defenders of the Worlds Nation: Rise of...three page comic book named "Defenders of the Worlds Nation: Rise of Captain Eagle". It's possibly the start of a larger story. The three pages are part of the main heroes origin story. Included is the script so people can read it and know what it is I want.

    $161 (Avg Bid)
    $161 Avg Bid
    30 bids

    It is a novel about a man who must leave his family to live in the dirty depths of the forest. About a father who is haunted by the screams of his family dying ...son's manipulated mind and the sister priest that stalks her every move. Bruno, who will choose a woman despite the world against him, not for the colour of her skin but the soul underneath.

    $488 (Avg Bid)
    $488 Avg Bid
    82 bids

    I need a kind soul to "tweak" my logo. The design is already complete - I just need 2 words added. I'd do this myself if I was at home with illustrator, but alas, I am not. Should only take a matter of minutes. Better yet - help me with this one, and I have a much larger "brochure-type"marketing collateral piece that need attention after this

    $25 (Avg Bid)
    $25 Avg Bid
    57 bids

    ...is a row without an origin city, skip that row. Data will be listed in blocks with different contact information for each block, contact information will be located above the block of data. The output should be a pipe (|) delimited file with the following column mappings: origin_city --> data located in the "Load Origin" column before the ,

    $152 (Avg Bid)
    $152 Avg Bid
    18 bids

    ...handicrafts, glittering gems, throbbing towns, wildlife sanctuaries, pulsating festivities and touching hospitality are the major attractions for tourist.  Odisha Tourism is where soul meets character. About the Logo Working across traditional silos and encompassing all our key tourism elements, we would like the logo to guide people smoothly from our

    $41 (Avg Bid)
    Guaranteed
    $41
    23 entries

    Looking for a wordsmith to help rewrite an already well written sales page. This is essentially a rewriting job but the content written should touch the soul of the reader to encourage decision making. There are around 1400 words. Your copy needs to between 1200 and 1400 words. You will need to have create writing skills and experience of writing

    $76 (Avg Bid)
    $76 Avg Bid
    41 bids
    Trophy icon Festival Look & Feel Ended

    ...4eGshHhODzmocuL_9Bw/view?usp=sharing Inspiration: [login to view URL] Think chic, luxe lifestyle, energy, textures, vibe, NOT "Caribbean", island, soul, culture...

    $44 (Avg Bid)
    Guaranteed
    $44
    31 entries